PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026146.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 380aa    MW: 42234.4 Da    PI: 6.4995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026146.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding316e-101467148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHH.....HHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktI.....artmg.kgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++    g+W++      a++ + + R++k+c++rw +yl
      Pbr026146.1 14 RGLWSPEEDEKLINYITTNSHGCWSSFllfkfASMRPgLQRCGKSCRLRWINYL 67
                     788*******************776521111144444899************97 PP

2Myb_DNA-binding48.32.3e-1573115145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
      Pbr026146.1  73 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 115
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-20670IPR009057Homeodomain-like
PROSITE profilePS500909.047967IPR017877Myb-like domain
SuperFamilySSF466891.27E-2511114IPR009057Homeodomain-like
SMARTSM007172.8E-51369IPR001005SANT/Myb domain
PfamPF002499.2E-81467IPR001005SANT/Myb domain
CDDcd001672.81E-71767No hitNo description
PROSITE profilePS5129425.20968122IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2571123IPR009057Homeodomain-like
SMARTSM007171.5E-1572120IPR001005SANT/Myb domain
PfamPF002493.6E-1473116IPR001005SANT/Myb domain
CDDcd001673.14E-1175115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TNSHGCWSSF LLFKFASMRP GLQRCGKSCR  60
LRWINYLRPD LKRGSFSPQE AALIIELHSI LGNRWAQIAK HLPGRTDNEV KNFWNSSIKK  120
KLISHEVIPA FASFSNDHIH NPSGHGSEEG FFTLNTNPNL CSQPQDQLYL PIVPSPVPSL  180
GLNYHGDFNN ILKLDQTNYA SNFVDHFLPP FQLPSNNASS YESSSWSLGY QPQQQFDPNI  240
QQVQNFSINE AAAAQYNNIG NELMVPISMA SSEPVAYENP FILPTVPKFC EIIDGNVCRM  300
PILYPSDLQE LDSLAKLSCF TSGHGSHPQD LQFPSNQLEC IDAIMSLLPS SSSSSSPSSA  360
SPSLLPLSSS QFDANFNAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141227108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4765816e-48AM476581.2 Vitis vinifera contig VV78X241396.15, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355527.10.0PREDICTED: myb-related protein B-like
RefseqXP_009355528.10.0PREDICTED: myb-related protein B-like
TrEMBLM5WVT11e-174M5WVT1_PRUPE; Uncharacterized protein
STRINGGLYMA07G01050.21e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.24e-73myb domain protein 26